Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36A Peptide - middle region

RPL36A Peptide - middle region

Product Specifications

Product Name Alternative

L44L, MGC72020, MIG6, RPL44

UniProt

P83881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL36A Rabbit Polyclonal Antibody (orb326574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066357

Preservative

Lyophilized powder

AA Sequence

PHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLC2 (NM_022822) Human Over-expression Lysate
LY402950 100 µg

KLC2 (NM_022822) Human Over-expression Lysate

Sign In for Pricing
View Details
NucSpot® Far-Red, 1000X in DMSO
#40085 1x 500 µL

NucSpot® Far-Red, 1000X in DMSO

Sign In for Pricing
View Details
Chlorpyrifos
TRC-C425300-50MG 50 mg

Chlorpyrifos

Sign In for Pricing
View Details
Human RBP4 (Retinol Binding Protein 4) ELISA Kit
E-EL-H1581-01 24 Tests

Human RBP4 (Retinol Binding Protein 4) ELISA Kit

Sign In for Pricing
View Details
Human RBP4 (Retinol Binding Protein 4) ELISA Kit
E-EL-H1581-02 48 Tests

Human RBP4 (Retinol Binding Protein 4) ELISA Kit

Sign In for Pricing
View Details
Human RBP4 (Retinol Binding Protein 4) ELISA Kit
E-EL-H1581-03 96 Tests

Human RBP4 (Retinol Binding Protein 4) ELISA Kit

Sign In for Pricing
View Details