Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36A Peptide - middle region

RPL36A Peptide - middle region

Product Specifications

Product Name Alternative

L44L, MGC72020, MIG6, RPL44

UniProt

P83881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL36A Rabbit Polyclonal Antibody (orb326574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066357

Preservative

Lyophilized powder

AA Sequence

PHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H2C (NM_001098728) Human Over-expression Lysate
LY420670 100 µg

GTF2H2C (NM_001098728) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Zfp101 activation kit by CRISPRa
GA204681 1 Kit

Mouse Zfp101 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Tcl1b2 activation kit by CRISPRa
GA205139 1 Kit

Mouse Tcl1b2 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Phenyl 2-Bromo-5-Fluorobenzamide
TRC-P400985-500MG 500 mg

N-Phenyl 2-Bromo-5-Fluorobenzamide

Sign In for Pricing
View Details
Human Radixin (RDX) activation kit by CRISPRa
GA104061 1 Kit

Human Radixin (RDX) activation kit by CRISPRa

Sign In for Pricing
View Details
HLA-DQ (MHC II) (HLA-DQA1/2866R), CF405S conjugate, 0.1mg/mL
BNC042866-500 1x 500 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details