Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLVCR2 Peptide - C-terminal region

FLVCR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf58, CCT, FLJ20371, FLVCRL14q, EPV, PVHH, MFSD7C

UniProt

Q9UPI3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLVCR2 Rabbit Polyclonal Antibody (orb586474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182212

Preservative

Lyophilized powder

AA Sequence

CVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phpt1 Rat shRNA Lentiviral Particle (Locus ID 296571)
TL705136V 500 µL Each

Phpt1 Rat shRNA Lentiviral Particle (Locus ID 296571)

Sign In for Pricing
View Details
Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated
bs-43206P-Biotin-01 20 µg

Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated

Sign In for Pricing
View Details
Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated
bs-43206P-Biotin-02 100 µg

Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated

Sign In for Pricing
View Details
Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated
bs-43206P-Biotin-03 500 µg

Recombinant mouse FCGRT&B2M Heterodimer protein, C-His (HEK293), Biotin Conjugated

Sign In for Pricing
View Details
Fragile X Mental Retardation 1 (FMR1) Antibody
abx241521-01 50 µL

Fragile X Mental Retardation 1 (FMR1) Antibody

Sign In for Pricing
View Details
Fragile X Mental Retardation 1 (FMR1) Antibody
abx241521-02 100 µL

Fragile X Mental Retardation 1 (FMR1) Antibody

Sign In for Pricing
View Details