Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDGA2 Peptide - C-terminal region

MDGA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAMDC1, c14_5286

UniProt

Q7Z553

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MDGA2 Rabbit Polyclonal Antibody (orb586493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878250

Preservative

Lyophilized powder

AA Sequence

TATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG3 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61621R-APC-Cy7 100 µL

Human IgG3 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Human Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Anti-antigen ELISA Kit
EKN52970 96 Tests

Human Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Anti-antigen ELISA Kit

Sign In for Pricing
View Details
DUT Rabbit Monoclonal Antibody [KD Validation]
E51K61945 40 µL

DUT Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Lentiviral mouse Uqcrq shRNA (UAS) - Lentiviral mouse Uqcrq shRNA (UAS, RFP) (25)
GTR15222011 1 Vial

Lentiviral mouse Uqcrq shRNA (UAS) - Lentiviral mouse Uqcrq shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
HSPB9 CRISPR Activation Plasmid (m2)
sc-429097-ACT-2 20 µg

HSPB9 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
MLIP-AS1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV733605 1.0 µg DNA

MLIP-AS1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details