Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDGA2 Peptide - C-terminal region

MDGA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAMDC1, c14_5286

UniProt

Q7Z553

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MDGA2 Rabbit Polyclonal Antibody (orb586493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878250

Preservative

Lyophilized powder

AA Sequence

TATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S. Muscles Membrane Protein
HT-102-MEM 1 Each

Human S. Muscles Membrane Protein

Sign In for Pricing
View Details
USP21 (NM_012475) Human Tagged Lenti ORF Clone
RC210554L1 10 µg

USP21 (NM_012475) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GRP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0909607 1.0 µg DNA

GRP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ATP1B4 antibody
70R-6783 100 µL

ATP1B4 antibody

Sign In for Pricing
View Details
Human DCAF15 Pre-designed siRNA Set B
SI004014B 1 Each

Human DCAF15 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal BRAF35 Antibody
NBP2-55629 100 µL

Rabbit Polyclonal BRAF35 Antibody

Sign In for Pricing
View Details