Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp708 Peptide - middle region

Zfp708 Peptide - middle region

Product Specifications

Product Name Alternative

AU021768, BC038328, MGC102251, Rslcan11

UniProt

F2Z422

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp708 Rabbit Polyclonal Antibody (orb324359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012450

Preservative

Lyophilized powder

AA Sequence

GEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO3 (NM_001976) Human Recombinant Protein
TP319257M 100 µg

ENO3 (NM_001976) Human Recombinant Protein

Sign In for Pricing
View Details
PAX6 (NM_001604) Human Over-expression Lysate
LY419854 100 µg

PAX6 (NM_001604) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Genomic DNA, Spleen
CD565017 5 µg

Tissue Genomic DNA, Spleen

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), 1mg/mL
BNUM1484-50 1x 50 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), 1mg/mL

Sign In for Pricing
View Details
Tma16 Mouse Gene Knockout Kit (CRISPR)
KN517652 1 Kit

Tma16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ormetoprim
TRC-O686800-250MG 250 mg

Ormetoprim

Sign In for Pricing
View Details