Zfp708 Peptide - middle region
Zfp708 Peptide - middle region
Product Specifications
Product Name Alternative
AU021768, BC038328, MGC102251, Rslcan11
UniProt
F2Z422
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp708 Rabbit Polyclonal Antibody (orb324359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012450
Preservative
Lyophilized powder
AA Sequence
GEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]](https://cdn.genprice.uk/products/763/68dd14a9061270361e7d2674/imageurl/e-ab-f1122j.webp)
E-AB-F1122J-01 50 Tests
PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details E-AB-F1122J-02 100 Tests
PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details E-AB-F1122J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
Sign In for Pricing
View Details 
BNC471331-250 1x 250 µL
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF647 Conjugate, 0.1 mg/mL
Sign In for Pricing
View Details 
TRC-T767710-100MG 100 mg
2-(2,3,5-Tri-O-benzoyl-Beta-D-ribofuranosyl)-4-thiazolecarboxylic Acid Ethyl Ester
Sign In for Pricing
View Details 