Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Peptide - N-terminal region

TRAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSP75, HSP90L

UniProt

Q12931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAP1 Rabbit Polyclonal Antibody (orb573595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057376

Preservative

Lyophilized powder

AA Sequence

RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHO1 Human Over-expression Lysate
orb1348830 100 µg

PLEKHO1 Human Over-expression Lysate

Sign In for Pricing
View Details
Eukaryotic High Mobility Group Protein 1 (HMGB1)
SFPA124Hu62-01 10 µg

Eukaryotic High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Eukaryotic High Mobility Group Protein 1 (HMGB1)
SFPA124Hu62-02 50 µg

Eukaryotic High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Eukaryotic High Mobility Group Protein 1 (HMGB1)
SFPA124Hu62-03 200 µg

Eukaryotic High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Eukaryotic High Mobility Group Protein 1 (HMGB1)
SFPA124Hu62-04 1 mg

Eukaryotic High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Eukaryotic High Mobility Group Protein 1 (HMGB1)
SFPA124Hu62-05 5 mg

Eukaryotic High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details