Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl2l2 Peptide - C-terminal region

Bcl2l2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW048834, Bcl-w, Gtrgal2, Gtrosa41, bclw, c98

UniProt

P70345

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl2l2 Rabbit Polyclonal Antibody (orb573640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031563

Preservative

Lyophilized powder

AA Sequence

VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MB67 Polyclonal Antibody
UB-GEN-3242 100 µL

MB67 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CLIP Antibody / ACTH
V8017-100UG 100 µg

Recombinant CLIP Antibody / ACTH

Sign In for Pricing
View Details
ETAA1 Recombinant Rabbit mAb
ARM1817-01 30 µL

ETAA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ETAA1 Recombinant Rabbit mAb
ARM1817-02 50 μL

ETAA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ETAA1 Recombinant Rabbit mAb
ARM1817-03 100 µL

ETAA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GC Column, H3-1701, 50m*0.25mm*0.5um, 1pc/pk
14051126 1 PC

GC Column, H3-1701, 50m*0.25mm*0.5um, 1pc/pk

Sign In for Pricing
View Details