Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Peptide - C-terminal region

CTNNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTNNB, DKFZp686D02253, FLJ25606, FLJ37923

UniProt

P35222

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_001895

Preservative

Lyophilized powder

AA Sequence

LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1469 (NM_146695) Mouse Tagged ORF Clone Lentiviral Particle
MR213714L3V 200 µL

Olfr1469 (NM_146695) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Octanoyltransferase (lipB)
MBS1380210-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Octanoyltransferase (lipB)
MBS1380210-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Octanoyltransferase (lipB)
MBS1380210-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Octanoyltransferase (lipB)
MBS1380210-04 0.1 mg (Yeast)

Recombinant Xylella fastidiosa Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Octanoyltransferase (lipB)
MBS1380210-05 0.02 mg (Baculovirus)

Recombinant Xylella fastidiosa Octanoyltransferase (lipB)

Sign In for Pricing
View Details