Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO1 Peptide - C-terminal region

FOXO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKH1, FKHR, FOXO1A

UniProt

Q12778

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXO1 Rabbit Polyclonal Antibody (orb573697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002006

Preservative

Lyophilized powder

AA Sequence

PPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD55 Antibody (6H940)
TMAB-04025-01 25 µL

Anti-CD55 Antibody (6H940)

Sign In for Pricing
View Details
Anti-CD55 Antibody (6H940)
TMAB-04025-02 50 μL

Anti-CD55 Antibody (6H940)

Sign In for Pricing
View Details
Anti-CD55 Antibody (6H940)
TMAB-04025-03 100 µL

Anti-CD55 Antibody (6H940)

Sign In for Pricing
View Details
(1S) - (-) -alpha-Pinene
89992544-1kg 1 Kg

(1S) - (-) -alpha-Pinene

Sign In for Pricing
View Details
Mouse Crystallin Beta A1 (CRYbA1) CLIA Kit
abx494872-01 96 Tests

Mouse Crystallin Beta A1 (CRYbA1) CLIA Kit

Sign In for Pricing
View Details
Mouse Crystallin Beta A1 (CRYbA1) CLIA Kit
abx494872-02 5x 96 Tests

Mouse Crystallin Beta A1 (CRYbA1) CLIA Kit

Sign In for Pricing
View Details