Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARA Peptide - middle region

RARA Peptide - middle region

Product Specifications

Product Name Alternative

NR1B1, RAR

UniProt

P10276

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX2 Rabbit Polyclonal Antibody (orb573743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000955

Preservative

Lyophilized powder

AA Sequence

DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HAI-1/HGFA Inhibitor 1 Antibody (OTI4H2)
NBP2-01969 0.1 mL

Mouse Monoclonal HAI-1/HGFA Inhibitor 1 Antibody (OTI4H2)

Sign In for Pricing
View Details
Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein
RPC31846-01 20 µg

Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein

Sign In for Pricing
View Details
Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein
RPC31846-02 100 µg

Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein

Sign In for Pricing
View Details
Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein
RPC31846-03 1 mg

Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein

Sign In for Pricing
View Details
HOPX (NM_139212) Human Over-expression Lysate
LC408357 20 µg

HOPX (NM_139212) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC30A3 3'UTR Luciferase Stable Cell Line
TU023553 1.0 mL

SLC30A3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details