Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARA Peptide - middle region

RARA Peptide - middle region

Product Specifications

Product Name Alternative

NR1B1, RAR

UniProt

P10276

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX2 Rabbit Polyclonal Antibody (orb573743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000955

Preservative

Lyophilized powder

AA Sequence

DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-20R Alpha Polyclonal Antibody
JOT-AP04474-01 20 µL

IL-20R Alpha Polyclonal Antibody

Sign In for Pricing
View Details
IL-20R Alpha Polyclonal Antibody
JOT-AP04474-02 50 μL

IL-20R Alpha Polyclonal Antibody

Sign In for Pricing
View Details
IL-20R Alpha Polyclonal Antibody
JOT-AP04474-03 100 µL

IL-20R Alpha Polyclonal Antibody

Sign In for Pricing
View Details
Sycn sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3485002 1.0 µg DNA

Sycn sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
BOLA1 Antibody, HRP conjugated
CSB-PA002774LB01HU-01 50 µg

BOLA1 Antibody, HRP conjugated

Sign In for Pricing
View Details
BOLA1 Antibody, HRP conjugated
CSB-PA002774LB01HU-02 100 µg

BOLA1 Antibody, HRP conjugated

Sign In for Pricing
View Details