Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo1 Peptide - C-terminal region

Lmo1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dat1, Lmo3

UniProt

D4A8W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo1 Rabbit Polyclonal Antibody (orb573760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620812

Preservative

Lyophilized powder

AA Sequence

NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGHLNGTFESQVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human NKX2-5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)
IRBAMLNKX2-5AP41200UL 1 Each

Rabbit Anti Human NKX2-5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)

Sign In for Pricing
View Details
RIG-I Double Nickase Plasmid (m2)
sc-432915-NIC-2 20 µg

RIG-I Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Biotin)
MBS6261428-01 0.1 mL

S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Biotin)

Sign In for Pricing
View Details
S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Biotin)
MBS6261428-02 5x 0.1 mL

S100 Protein (Protein S100, S-100 Protein, S100 Calcium-binding Protein) (Biotin)

Sign In for Pricing
View Details
RBM12 293 Cell Lysate
404176 0.1 mg

RBM12 293 Cell Lysate

Sign In for Pricing
View Details
DPH7 Antibody, HRP conjugated
MBS7046459-01 0.05 mg

DPH7 Antibody, HRP conjugated

Sign In for Pricing
View Details