Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo1 Peptide - C-terminal region

Lmo1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dat1, Lmo3

UniProt

D4A8W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo1 Rabbit Polyclonal Antibody (orb573760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620812

Preservative

Lyophilized powder

AA Sequence

NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGHLNGTFESQVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Nucleobindin 2 (NUCB2)
RPU43104-01 50 µg

Recombinant Human Nucleobindin 2 (NUCB2)

Sign In for Pricing
View Details
Recombinant Human Nucleobindin 2 (NUCB2)
RPU43104-02 100 µg

Recombinant Human Nucleobindin 2 (NUCB2)

Sign In for Pricing
View Details
Recombinant Human Nucleobindin 2 (NUCB2)
RPU43104-03 1 mg

Recombinant Human Nucleobindin 2 (NUCB2)

Sign In for Pricing
View Details
Porcine Interleukin-7,IL7 ELISA KIT
ELI-02325p 96 Tests

Porcine Interleukin-7,IL7 ELISA KIT

Sign In for Pricing
View Details
Aspidium, rhizome t.s.
Pt132c 7.6 x 2.6 cm

Aspidium, rhizome t.s.

Sign In for Pricing
View Details
AK1 Antibody - middle region : FITC (ARP48149_P050-FITC)
ARP48149_P050-FITC 100 µL

AK1 Antibody - middle region : FITC (ARP48149_P050-FITC)

Sign In for Pricing
View Details