Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hlf Peptide - N-terminal region

Hlf Peptide - N-terminal region

Product Specifications

Product Name Alternative

E230015K02Rik

UniProt

Q8BW74

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hlf Rabbit Polyclonal Antibody (orb573772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766151

Preservative

Lyophilized powder

AA Sequence

MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKDKGKKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butyl Triacontanoate
TRC-B750100-5MG 5 mg

Butyl Triacontanoate

Sign In for Pricing
View Details
CaMKII alpha Antibody
KC-35854-01 50 μL

CaMKII alpha Antibody

Sign In for Pricing
View Details
CaMKII alpha Antibody
KC-35854-02 100 µL

CaMKII alpha Antibody

Sign In for Pricing
View Details
CaMKII alpha Antibody
KC-35854-03 1 mL

CaMKII alpha Antibody

Sign In for Pricing
View Details
Plant/Fungi DNA Isolation Kit-250p
26250 250 Preparations

Plant/Fungi DNA Isolation Kit-250p

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR561391 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details