Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hlf Peptide - N-terminal region

Hlf Peptide - N-terminal region

Product Specifications

Product Name Alternative

E230015K02Rik

UniProt

Q8BW74

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hlf Rabbit Polyclonal Antibody (orb573772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766151

Preservative

Lyophilized powder

AA Sequence

MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKDKGKKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STRC activation kit by CRISPRa
GA116026 1 Kit

Human STRC activation kit by CRISPRa

Sign In for Pricing
View Details
CITCO
TRC-C433048-1MG 1 mg

CITCO

Sign In for Pricing
View Details
S100B (4C4.9), CF660R conjugate, 0.1mg/mL
BNC610143-500 1x 500 µL

S100B (4C4.9), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
96 deep square well 2.0mL polyethylene toughened genomics plate
IPD1196-MP 1 Each

96 deep square well 2.0mL polyethylene toughened genomics plate

Sign In for Pricing
View Details
Human CA9 Antibody Pair Set
E-KAB-0415 50 µL & 100 µg

Human CA9 Antibody Pair Set

Sign In for Pricing
View Details
Anapc11 (NM_001038230) Mouse Tagged ORF Clone
MG200172 10 µg

Anapc11 (NM_001038230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details