Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafg Peptide - N-terminal region

Mafg Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA545192, C630022N07Rik

UniProt

O54790

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mafg Rabbit Polyclonal Antibody (orb574017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034886

Preservative

Lyophilized powder

AA Sequence

TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R1C (NM_001080545) Human Recombinant Protein
TP305047M 100 µg

PPP1R1C (NM_001080545) Human Recombinant Protein

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-01 60 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-02 120 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-03 200 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
CD21 Mouse Monoclonal Antibody [A4E5]
HA600001 100 µL

CD21 Mouse Monoclonal Antibody [A4E5]

Sign In for Pricing
View Details
RYBP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]
TA504652AM 100 µL

RYBP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details