Mafg Peptide - N-terminal region
Mafg Peptide - N-terminal region
Product Specifications
Product Name Alternative
AA545192, C630022N07Rik
UniProt
O54790
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mafg Rabbit Polyclonal Antibody (orb574017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034886
Preservative
Lyophilized powder
AA Sequence
TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA362492 100 µL
TGF beta Receptor I (TGFBR1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC042002-500 1x 500 µL
PD1, Mouse (RMP1-14), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY421737 100 µg
TBC1D3G (NM_001040282) Human Over-expression Lysate
Sign In for Pricing
View Details 