Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aes Peptide - N-terminal region

Aes Peptide - N-terminal region

Product Specifications

Product Name Alternative

AL024115, Grg, Grg5

UniProt

P63002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aes Rabbit Polyclonal Antibody (orb574136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034477

Preservative

Lyophilized powder

AA Sequence

QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MB COOH
MB300003.5G 5 g

TentaGel® MB COOH

Sign In for Pricing
View Details
SLC47A1 Rabbit Polyclonal Antibody
TA381669 100 µL

SLC47A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate
LY403449 100 µg

CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate

Sign In for Pricing
View Details
NF-L Recombinant Chimeric Antibody Antibody
HA610249 100 µg

NF-L Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
MIR205HG Human Gene Knockout Kit (CRISPR)
KN415980 1 Kit

MIR205HG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-PPP2R5E
Y158413 100 µL

Anti-PPP2R5E

Sign In for Pricing
View Details