Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aes Peptide - N-terminal region

Aes Peptide - N-terminal region

Product Specifications

Product Name Alternative

AL024115, Grg, Grg5

UniProt

P63002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aes Rabbit Polyclonal Antibody (orb574136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034477

Preservative

Lyophilized powder

AA Sequence

QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Corey Lactone
TRC-C695000-5G 5 g

(-)-Corey Lactone

Sign In for Pricing
View Details
NOLC1 (NM_004741) Human Over-expression Lysate
LC401495 20 µg

NOLC1 (NM_004741) Human Over-expression Lysate

Sign In for Pricing
View Details
c-Myb (MYB) Human Gene Knockout Kit (CRISPR)
KN209061 1 Kit

c-Myb (MYB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HGF / SF (EGH2 4C12.1), CF568 conjugate, 0.1mg/mL
BNC682841-500 1x 500 µL

HGF / SF (EGH2 4C12.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 Mouse Monoclonal Antibody [Clone ID: OTI10C2]
CF811289 100 µg

CD14 Mouse Monoclonal Antibody [Clone ID: OTI10C2]

Sign In for Pricing
View Details
Nitenpyram
TRC-N490115-1G 1 g

Nitenpyram

Sign In for Pricing
View Details