Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx3 Peptide - middle region

Alx3 Peptide - middle region

Product Specifications

UniProt

Q6RW14

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Alx3 Rabbit Polyclonal Antibody (orb574255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007013

Preservative

Lyophilized powder

AA Sequence

FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: sigmoid
CS714474 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Acetylacetonatobis(ethylene)rhodium(I)
TRC-A171193-5MG 5 mg

Acetylacetonatobis(ethylene)rhodium(I)

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-3-O-(Beta-D-galactopyranosyl)-Alpha-D-glucopyranoside
TRC-B212532-25MG 25 mg

Benzyl 2-Acetamido-2-deoxy-3-O-(Beta-D-galactopyranosyl)-Alpha-D-glucopyranoside

Sign In for Pricing
View Details
CACNG5 Polyclonal Antibody
E-AB-19655-01 20 µL

CACNG5 Polyclonal Antibody

Sign In for Pricing
View Details
CACNG5 Polyclonal Antibody
E-AB-19655-02 60 µL

CACNG5 Polyclonal Antibody

Sign In for Pricing
View Details
CACNG5 Polyclonal Antibody
E-AB-19655-03 120 µL

CACNG5 Polyclonal Antibody

Sign In for Pricing
View Details