Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx3 Peptide - middle region

Alx3 Peptide - middle region

Product Specifications

UniProt

Q6RW14

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Alx3 Rabbit Polyclonal Antibody (orb574255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007013

Preservative

Lyophilized powder

AA Sequence

FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 7 (STX7) Rabbit Polyclonal Antibody
TA369382 100 µL

Syntaxin 7 (STX7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PITPNB Mouse Monoclonal Antibody [Clone ID: OTI5B10]
CF809352 100 µg

PITPNB Mouse Monoclonal Antibody [Clone ID: OTI5B10]

Sign In for Pricing
View Details
Benchtop Low Speed Centrifuge BCBL-207
BCBL-207 1 Unit

Benchtop Low Speed Centrifuge BCBL-207

Sign In for Pricing
View Details
Bis(acetonitrile)dichloropalladium(II)
TRC-B399850-500MG 500 mg

Bis(acetonitrile)dichloropalladium(II)

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-280-01 50 μL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-280-02 100 µL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details