Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIPK2 Peptide - middle region

HIPK2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686K02111, FLJ23711, PRO0593

UniProt

Q9H2X6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIPK2 Rabbit Polyclonal Antibody (orb574278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_073577

Preservative

Lyophilized powder

AA Sequence

MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1144 ORF Vector (Rat) (pORF)
33703016 1.0 µg DNA

Olr1144 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
NR2F6 siRNA (Rat)
CRR3573-01 15 nmol

NR2F6 siRNA (Rat)

Sign In for Pricing
View Details
NR2F6 siRNA (Rat)
CRR3573-02 30 nmol

NR2F6 siRNA (Rat)

Sign In for Pricing
View Details
Human Prohibitin (PHB) ELISA Kit
MBS2020364-01 24 Strip Well

Human Prohibitin (PHB) ELISA Kit

Sign In for Pricing
View Details
Human Prohibitin (PHB) ELISA Kit
MBS2020364-02 48 Well

Human Prohibitin (PHB) ELISA Kit

Sign In for Pricing
View Details
Human Prohibitin (PHB) ELISA Kit
MBS2020364-03 96 Well

Human Prohibitin (PHB) ELISA Kit

Sign In for Pricing
View Details