Evx2 Peptide - N-terminal region
Evx2 Peptide - N-terminal region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Evx2 Rabbit Polyclonal Antibody (orb574317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_221512
Preservative
Lyophilized powder
AA Sequence
PRLPSAPLHGALGDLPAKGKFEIDTLFNLQHPSSESTVSSEIASATESRK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741448-500 1x 500 µL
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH032885-01 10 µg
Recombinant Human Peroxiredoxin 5/PRDX5 Protein (His Tag)
Sign In for Pricing
View Details PKSH032885-02 50 µg
Recombinant Human Peroxiredoxin 5/PRDX5 Protein (His Tag)
Sign In for Pricing
View Details 
