Evx2 Peptide - N-terminal region
Evx2 Peptide - N-terminal region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Evx2 Rabbit Polyclonal Antibody (orb574317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_221512
Preservative
Lyophilized powder
AA Sequence
PRLPSAPLHGALGDLPAKGKFEIDTLFNLQHPSSESTVSSEIASATESRK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682493-100 1x 100 µL
AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882244-500 1x 500 µL
Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
