Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes6 Peptide - middle region

Hes6 Peptide - middle region

Product Specifications

Product Name Alternative

AI326893, bHLHb41

UniProt

Q9JHE6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hes6 Rabbit Polyclonal Antibody (orb574433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062352

Preservative

Lyophilized powder

AA Sequence

LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-01 0.5 mg (E-Coli)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details
Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-02 0.05 mg (Baculovirus)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details
Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-03 0.5 mg (Yeast)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details
Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-04 0.05 mg (Mammalian-Cell)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details
Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-05 1 mg (E-Coli)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details
Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial
MBS1393933-06 0.1 mg (Baculovirus)

Recombinant Bovine Glycosyltransferase 8 domain-containing protein 2 (GLT8D2), partial

Sign In for Pricing
View Details