Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes6 Peptide - middle region

Hes6 Peptide - middle region

Product Specifications

Product Name Alternative

AI326893, bHLHb41

UniProt

Q9JHE6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hes6 Rabbit Polyclonal Antibody (orb574433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062352

Preservative

Lyophilized powder

AA Sequence

LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECAM-1 (10G9) Alexa Fluor® 680
sc-13537 AF680 200 µg/mL

PECAM-1 (10G9) Alexa Fluor® 680

Sign In for Pricing
View Details
FGF-1/FGF-Acidic Protein, Bovine
UA040311-01 5 µg

FGF-1/FGF-Acidic Protein, Bovine

Sign In for Pricing
View Details
FGF-1/FGF-Acidic Protein, Bovine
UA040311-02 10 µg

FGF-1/FGF-Acidic Protein, Bovine

Sign In for Pricing
View Details
FGF-1/FGF-Acidic Protein, Bovine
UA040311-03 50 µg

FGF-1/FGF-Acidic Protein, Bovine

Sign In for Pricing
View Details
FGF-1/FGF-Acidic Protein, Bovine
UA040311-04 100 µg

FGF-1/FGF-Acidic Protein, Bovine

Sign In for Pricing
View Details
FGF-1/FGF-Acidic Protein, Bovine
UA040311-05 500 µg

FGF-1/FGF-Acidic Protein, Bovine

Sign In for Pricing
View Details