Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b Peptide - C-terminal region

Wnt8b Peptide - C-terminal region

Product Specifications

UniProt

Q9WUD6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt8b Rabbit Polyclonal Antibody (orb574689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035850

Preservative

Lyophilized powder

AA Sequence

IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sgip1 Mouse siRNA Oligo Duplex (Locus ID 73094)
SR420304 1 Kit

Sgip1 Mouse siRNA Oligo Duplex (Locus ID 73094)

Sign In for Pricing
View Details
(3- ((tert-Butoxycarbonyl) amino) bicyclo[1.1.1]pentan-1-yl) methyl methanesulfonate
OR1037341-01 100 mg

(3- ((tert-Butoxycarbonyl) amino) bicyclo[1.1.1]pentan-1-yl) methyl methanesulfonate

Sign In for Pricing
View Details
(3- ((tert-Butoxycarbonyl) amino) bicyclo[1.1.1]pentan-1-yl) methyl methanesulfonate
OR1037341-02 250 mg

(3- ((tert-Butoxycarbonyl) amino) bicyclo[1.1.1]pentan-1-yl) methyl methanesulfonate

Sign In for Pricing
View Details
C24-Ceramide-d7
HY-134508S 500 µg

C24-Ceramide-d7

Sign In for Pricing
View Details
CELSR1 Knockout 786-O Polyclonal Cells
ARG5666 1 Million

CELSR1 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
OR10H5 Human siRNA Oligo Duplex (Locus ID 284433)
SR317161 1 Kit

OR10H5 Human siRNA Oligo Duplex (Locus ID 284433)

Sign In for Pricing
View Details