6720456H20Rik Peptide - middle region
6720456H20Rik Peptide - middle region
Product Specifications
Product Name Alternative
5930435P15, 6720456H20Rik
UniProt
Q8BMD6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tmem260 Rabbit Polyclonal Antibody (orb324529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766188
Preservative
Lyophilized powder
AA Sequence
LFRLLKEKELTLSLLLRLTLAFSAGLLPYVYLPVSSYLSRARWTWGDQTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681081-100 1x 100 µL
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881462-500 1x 500 µL
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details