Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Peptide - C-terminal region

Hpcal1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NVP-3, Nvp3, VILIP3, Vnsl3, Vsnl3

UniProt

P62748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hpcal1 Rabbit Polyclonal Antibody (orb324571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057886

Preservative

Lyophilized powder

AA Sequence

DESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dicer (DICER1) Human Gene Knockout Kit (CRISPR)
KN211804RB 1 Kit

Dicer (DICER1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C2orf18 (SLC35F6) Rabbit Polyclonal Antibody
TA361112 100 µL

C2orf18 (SLC35F6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LAMA3 (NM_000227) Human Over-expression Lysate
LC424855 20 µg

LAMA3 (NM_000227) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA-DQB1 Rabbit Polyclonal Antibody
TA365993 100 µL

HLA-DQB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Poll Rabbit Polyclonal Antibody
TA362896 100 µL

Poll Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR51S1 Human Gene Knockout Kit (CRISPR)
KN415968 1 Kit

OR51S1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details