Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Peptide - C-terminal region

Hpcal1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NVP-3, Nvp3, VILIP3, Vnsl3, Vsnl3

UniProt

P62748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hpcal1 Rabbit Polyclonal Antibody (orb324571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057886

Preservative

Lyophilized powder

AA Sequence

DESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HypoGel® 400 FP
SP400110150170.5G 5 g

HypoGel® 400 FP

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-01 20 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-02 100 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-03 2x 100 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
2-(tert-Butylamino)-4-chloro-6-cyclopropylamino-1,3,5-triazine
TRC-B690326-5G 5 g

2-(tert-Butylamino)-4-chloro-6-cyclopropylamino-1,3,5-triazine

Sign In for Pricing
View Details
Homoveratrylamine
TRC-H669540-5G 5 g

Homoveratrylamine

Sign In for Pricing
View Details