Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmga1 Peptide - N-terminal region

Hmga1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hmgi, Hmgiy

UniProt

Q8K585

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hmga1 Rabbit Polyclonal Antibody (orb575255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_647543

Preservative

Lyophilized powder

AA Sequence

MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Setariae Fructus Germinatus Extract
C02520-5mg 5 mg

Setariae Fructus Germinatus Extract

Sign In for Pricing
View Details
SLC18A2 ELISA Kit (Mouse) (OKEI00589)
OKEI00589 96 Well

SLC18A2 ELISA Kit (Mouse) (OKEI00589)

Sign In for Pricing
View Details
Hydroxy Sulfentrazone
TRC-H977690-25MG 25 mg

Hydroxy Sulfentrazone

Sign In for Pricing
View Details
Rabbit Anti Human SRC Monoclonal Clone DDH-19 100UL
IRBAHUSRCDDH19C100UL 100 µL

Rabbit Anti Human SRC Monoclonal Clone DDH-19 100UL

Sign In for Pricing
View Details
MLF1, CT (MLF1, Myeloid leukemia factor 1, Myelodysplasia-myeloid leukemia factor 1) (MaxLight 750)
MBS6321062-01 0.1 mL

MLF1, CT (MLF1, Myeloid leukemia factor 1, Myelodysplasia-myeloid leukemia factor 1) (MaxLight 750)

Sign In for Pricing
View Details
MLF1, CT (MLF1, Myeloid leukemia factor 1, Myelodysplasia-myeloid leukemia factor 1) (MaxLight 750)
MBS6321062-02 5x 0.1 mL

MLF1, CT (MLF1, Myeloid leukemia factor 1, Myelodysplasia-myeloid leukemia factor 1) (MaxLight 750)

Sign In for Pricing
View Details