Hmga1 Peptide - N-terminal region
Hmga1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Hmgi, Hmgiy
UniProt
Q8K585
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hmga1 Rabbit Polyclonal Antibody (orb575255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_647543
Preservative
Lyophilized powder
AA Sequence
MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6236069-01 0.1 mL
USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-processing Protease FAF-Y, DFFR
Sign In for Pricing
View Details MBS6236069-02 5x 0.1 mL
USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-processing Protease FAF-Y, DFFR
Sign In for Pricing
View Details