Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gria3 Peptide - middle region

Gria3 Peptide - middle region

Product Specifications

Product Name Alternative

GLUR3, GluA3|GluR-3|GluR-C|GluR-K3

UniProt

P19492

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gria3 Rabbit Polyclonal Antibody (orb575347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116785

Preservative

Lyophilized powder

AA Sequence

TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI16 (FAM160B2) (NM_022749) Human Recombinant Protein
TP321662M 100 µg

RAI16 (FAM160B2) (NM_022749) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Uterus
CB618330 1 Block

Frozen Tissue Blocks, Uterus

Sign In for Pricing
View Details
PHF8 Rabbit Polyclonal Antibody
ER1803-37 100 µL

PHF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (CLH2), CF568 conjugate, 0.1mg/mL
BNC680897-100 1x 100 µL

Mucin 5AC (MUC5AC) (CLH2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559276 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
LMCD1 Rabbit Polyclonal Antibody
TA366235 100 µL

LMCD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details