Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gria3 Peptide - middle region

Gria3 Peptide - middle region

Product Specifications

Product Name Alternative

GLUR3, GluA3|GluR-3|GluR-C|GluR-K3

UniProt

P19492

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gria3 Rabbit Polyclonal Antibody (orb575347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116785

Preservative

Lyophilized powder

AA Sequence

TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr86 Mouse Gene Knockout Kit (CRISPR)
KN519393 1 Kit

Wdr86 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Water Chiller BCHI-212
BCHI-212 Each

Water Chiller BCHI-212

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-01 50 μL

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-02 100 µL

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-03 1 mL

VTA1 Antibody

Sign In for Pricing
View Details
Human ZNF169 activation kit by CRISPRa
GA116194 1 Kit

Human ZNF169 activation kit by CRISPRa

Sign In for Pricing
View Details