Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT8L2 Peptide - N-terminal region

CCT8L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CESK1, MGC118839, MGC118840

UniProt

Q96SF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055221

Preservative

Lyophilized powder

AA Sequence

ALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUDT22 activation kit by CRISPRa
GA113499 1 Kit

Human NUDT22 activation kit by CRISPRa

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2164), CF405S conjugate, 0.1mg/mL
BNC042164-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2164), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C16 Ceramide-1-phosphate Ammonium Salt
TRC-C616450-25MG 25 mg

C16 Ceramide-1-phosphate Ammonium Salt

Sign In for Pricing
View Details
(1R,2S,5S)-2-Hydroxy Metconazole
TRC-H193440-10MG 10 mg

(1R,2S,5S)-2-Hydroxy Metconazole

Sign In for Pricing
View Details
Human FAM53C activation kit by CRISPRa
GA109726 1 Kit

Human FAM53C activation kit by CRISPRa

Sign In for Pricing
View Details
BCL2 Mouse Monoclonal Antibody [Clone ID: OTI4C1]
CF806639 100 µg

BCL2 Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details