Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Peptide - middle region

Lrrfip1 Peptide - middle region

Product Specifications

Product Name Alternative

AU024550, Fliiap1

UniProt

G5E8E1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrfip1 Rabbit Polyclonal Antibody (orb575604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104782

Preservative

Lyophilized powder

AA Sequence

IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6.ccdb-Ncf1-r Plasmid
PVT20865 2 µg

pCMV-SPORT6.ccdb-Ncf1-r Plasmid

Sign In for Pricing
View Details
CREB1 Antibody - middle region : HRP (ARP39811_P050-HRP)
ARP39811_P050-HRP 100 µL

CREB1 Antibody - middle region : HRP (ARP39811_P050-HRP)

Sign In for Pricing
View Details
Collagen VII Rabbit pAb
E47R22189 100 µL

Collagen VII Rabbit pAb

Sign In for Pricing
View Details
Anti-ATGL Rabbit Monoclonal Antibody
M01800-1-200μl 200 µL

Anti-ATGL Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD209 Antibody (2B8), FITC
FHJ61611 100 Tests

Anti-Human CD209 Antibody (2B8), FITC

Sign In for Pricing
View Details
GADD34 (PPP1R15A) (NM_014330) Human Tagged Lenti ORF Clone
RC200581L2 10 µg

GADD34 (PPP1R15A) (NM_014330) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details