Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Peptide - middle region

Lrrfip1 Peptide - middle region

Product Specifications

Product Name Alternative

AU024550, Fliiap1

UniProt

G5E8E1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrfip1 Rabbit Polyclonal Antibody (orb575604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104782

Preservative

Lyophilized powder

AA Sequence

IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solvaperm Green G
T87416-01 10 mg

Solvaperm Green G

Sign In for Pricing
View Details
Solvaperm Green G
T87416-02 50 mg

Solvaperm Green G

Sign In for Pricing
View Details
Dynactin 2 Polyclonal Antibody
UB-GEN-3053 100 µL

Dynactin 2 Polyclonal Antibody

Sign In for Pricing
View Details
CRMP2 antibody
70R-CG011 100 ug

CRMP2 antibody

Sign In for Pricing
View Details
MIR4423 ORF Vector (Human) (pORF)
ORF024318 1.0 µg DNA

MIR4423 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RCC2 antibody - middle region
MBS3213279-01 0.1 mL

RCC2 antibody - middle region

Sign In for Pricing
View Details