Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja10 Peptide - middle region

Gja10 Peptide - middle region

Product Specifications

Product Name Alternative

Cx-57, Cx57|RGD1309630

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gja10 Rabbit Polyclonal Antibody (orb576038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166979

Preservative

Lyophilized powder

AA Sequence

TENETGPPFHSTNYSGAQQCMVCSSLPERVSLLQANNKQQVIRVNIPRSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cofilin 1 (CFL1) pSer3 Rabbit Polyclonal Antibody
AP02426PU-N 100 µL

Cofilin 1 (CFL1) pSer3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant BACE1 Antibody
RC-16872-01 50 μL

Recombinant BACE1 Antibody

Sign In for Pricing
View Details
Recombinant BACE1 Antibody
RC-16872-02 100 µL

Recombinant BACE1 Antibody

Sign In for Pricing
View Details
Recombinant BACE1 Antibody
RC-16872-03 1 mL

Recombinant BACE1 Antibody

Sign In for Pricing
View Details
Beta Dystroglycan Antibody
KC-8275-01 50 μL

Beta Dystroglycan Antibody

Sign In for Pricing
View Details
Beta Dystroglycan Antibody
KC-8275-02 100 µL

Beta Dystroglycan Antibody

Sign In for Pricing
View Details