Gja10 Peptide - middle region
Gja10 Peptide - middle region
Product Specifications
Product Name Alternative
Cx-57, Cx57|RGD1309630
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gja10 Rabbit Polyclonal Antibody (orb576038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001166979
Preservative
Lyophilized powder
AA Sequence
TENETGPPFHSTNYSGAQQCMVCSSLPERVSLLQANNKQQVIRVNIPRSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401190 20 µg
Nck beta (NCK2) (NM_003581) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC942395-500 1x 500 µL
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]](https://cdn.genprice.uk/products/937/68dd1b7b061270361ea1c1b3/imageurl/ta804411bm.webp)
TA804411BM 100 µL
IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]
Sign In for Pricing
View Details