Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a2 Peptide - C-terminal region

Nr5a2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ftf, Lrh-1

UniProt

Q9QWM1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr5a2 Rabbit Polyclonal Antibody (orb576654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068510

Preservative

Lyophilized powder

AA Sequence

QTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMBR1L Antibody - middle region (ARP78717_P050)
ARP78717_P050 100 µL

LMBR1L Antibody - middle region (ARP78717_P050)

Sign In for Pricing
View Details
TTI2 Antibody (HRP)
orb516765-01 50 µg

TTI2 Antibody (HRP)

Sign In for Pricing
View Details
TTI2 Antibody (HRP)
orb516765-02 100 µg

TTI2 Antibody (HRP)

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
RD83536A-01 60 μL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
RD83536A-02 120 μL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
RD83536A-03 200 µL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details