Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phox2b Peptide - N-terminal region

Phox2b Peptide - N-terminal region

Product Specifications

Product Name Alternative

NBPhox

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phox2b Rabbit Polyclonal Antibody (orb329984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001077800

Preservative

Lyophilized powder

AA Sequence

MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin (VIM) pSer71 Rat Monoclonal Antibody [Clone ID: TM71]
AM26458AF-N 100 µg

Vimentin (VIM) pSer71 Rat Monoclonal Antibody [Clone ID: TM71]

Sign In for Pricing
View Details
Human ADP/Acrp30 (Adiponectin) ELISA Kit
E-EL-H6122-01 24 Tests

Human ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
Human ADP/Acrp30 (Adiponectin) ELISA Kit
E-EL-H6122-02 48 Tests

Human ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
Human ADP/Acrp30 (Adiponectin) ELISA Kit
E-EL-H6122-03 96 Tests

Human ADP/Acrp30 (Adiponectin) ELISA Kit

Sign In for Pricing
View Details
TUBD1 (NM_016261) Human Recombinant Protein
TP761750 50 µg

TUBD1 (NM_016261) Human Recombinant Protein

Sign In for Pricing
View Details
Acvrl1 Mouse Gene Knockout Kit (CRISPR)
KN500805 1 Kit

Acvrl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details