Phox2b Peptide - N-terminal region
Phox2b Peptide - N-terminal region
Product Specifications
Product Name Alternative
NBPhox
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Phox2b Rabbit Polyclonal Antibody (orb329984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001077800
Preservative
Lyophilized powder
AA Sequence
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743055-100 1x 100 µL
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![beta Amyloid 1-40 Recombinant Rabbit Monoclonal Antibody [PSH03-98] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b65/imageurl/ha722078.webp)
HA722078 100 µL
beta Amyloid 1-40 Recombinant Rabbit Monoclonal Antibody [PSH03-98] - BSA and Azide free (Detector)
Sign In for Pricing
View Details 
BNC470531-500 1x 500 µL
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 