Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ciao1 Peptide - N-terminal region

Ciao1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW210570, Wdr39

UniProt

Q99KN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ciao1 Rabbit Polyclonal Antibody (orb576715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079572

Preservative

Lyophilized powder

AA Sequence

MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTHL1 Antibody
KC-7489-01 50 μL

NTHL1 Antibody

Sign In for Pricing
View Details
NTHL1 Antibody
KC-7489-02 100 µL

NTHL1 Antibody

Sign In for Pricing
View Details
NTHL1 Antibody
KC-7489-03 1 mL

NTHL1 Antibody

Sign In for Pricing
View Details
LATS2 (Center) Rabbit Polyclonal Antibody
AP13576PU-N 400 µL

LATS2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), 0.2mg/mL
BNUB1098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), 0.2mg/mL

Sign In for Pricing
View Details
2-Nitrophenol-3,4,5,6-d4
TRC-N496906-5MG 5 mg

2-Nitrophenol-3,4,5,6-d4

Sign In for Pricing
View Details