Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ciao1 Peptide - N-terminal region

Ciao1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW210570, Wdr39

UniProt

Q99KN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ciao1 Rabbit Polyclonal Antibody (orb576715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079572

Preservative

Lyophilized powder

AA Sequence

MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cox7c activation kit by CRISPRa
GA200846 1 Kit

Mouse Cox7c activation kit by CRISPRa

Sign In for Pricing
View Details
UBFD1 (N-term) Rabbit Polyclonal Antibody
AP54446PU-N 400 µL

UBFD1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL
BNC040834-100 1x 100 µL

Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRC2 Antibody
KC-42169-01 50 μL

MRC2 Antibody

Sign In for Pricing
View Details
MRC2 Antibody
KC-42169-02 100 µL

MRC2 Antibody

Sign In for Pricing
View Details
MRC2 Antibody
KC-42169-03 1 mL

MRC2 Antibody

Sign In for Pricing
View Details