Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc9 Peptide - C-terminal region

Hoxc9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hox-3.2

UniProt

P09633

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc9 Rabbit Polyclonal Antibody (orb576866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032298

Preservative

Lyophilized powder

AA Sequence

EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPS 2390
4134/50 50 mg

NPS 2390

Sign In for Pricing
View Details
GHR (Growth Hormone Receptor, GH Receptor, Somatotropin Receptor) (MaxLight 650)
127297-ML650 100 µL

GHR (Growth Hormone Receptor, GH Receptor, Somatotropin Receptor) (MaxLight 650)

Sign In for Pricing
View Details
S100B AAV Vector (Rat) (CMV)
42946106 1 µg

S100B AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae murD Protein (aa 1-438)
VAng-Lsx07478-500gEcoli 500 µg (E. coli)

Recombinant Shigella Dysenteriae murD Protein (aa 1-438)

Sign In for Pricing
View Details
LHX9 antibody - C-terminal region (ARP35966_T100)
ARP35966_T100 100 µL

LHX9 antibody - C-terminal region (ARP35966_T100)

Sign In for Pricing
View Details
2-{4-[3- (Trifluoromethyl) benzenesulfonamido]phenyl}acetic acid
KEB30535-01 50 mg

2-{4-[3- (Trifluoromethyl) benzenesulfonamido]phenyl}acetic acid

Sign In for Pricing
View Details