Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc9 Peptide - C-terminal region

Hoxc9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hox-3.2

UniProt

P09633

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc9 Rabbit Polyclonal Antibody (orb576866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032298

Preservative

Lyophilized powder

AA Sequence

EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH5A1 CRISPR Activation Plasmid (h2)
sc-406757-ACT-2 20 µg

ALDH5A1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
ACSL4 Antibody Blocking peptide
orb1456072 500 µg

ACSL4 Antibody Blocking peptide

Sign In for Pricing
View Details
IL10RA Polyclonal Antibody
MBS126399-01 0.02 mL

IL10RA Polyclonal Antibody

Sign In for Pricing
View Details
IL10RA Polyclonal Antibody
MBS126399-02 0.1 mL

IL10RA Polyclonal Antibody

Sign In for Pricing
View Details
IL10RA Polyclonal Antibody
MBS126399-03 5x 0.1 mL

IL10RA Polyclonal Antibody

Sign In for Pricing
View Details
H4-16 (NM_175054) Human Over-expression Lysate
LY406378 100 µg

H4-16 (NM_175054) Human Over-expression Lysate

Sign In for Pricing
View Details