Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pparg Peptide - C-terminal region

Pparg Peptide - C-terminal region

Product Specifications

UniProt

O88275

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pparg Rabbit Polyclonal Antibody (orb577006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138838

Preservative

Lyophilized powder

AA Sequence

HPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Mitochondrial import receptor subunit TOM22 homolog (TOMM22) ELISA kit
GTR10465685 96 Well

Porcine Mitochondrial import receptor subunit TOM22 homolog (TOMM22) ELISA kit

Sign In for Pricing
View Details
Recombinant Human CDIN1 Protein
E30P8420 20 µg

Recombinant Human CDIN1 Protein

Sign In for Pricing
View Details
Rat Erc1  ELISA Kit
EF018626 96 Tests

Rat Erc1 ELISA Kit

Sign In for Pricing
View Details
CENPQ Antibody
GWB-MU682G 50 µg

CENPQ Antibody

Sign In for Pricing
View Details
Monoclonal CD5 (Mantle Cell Lymphoma Marker) Antibody - With BSA and Azide, Clone: SPM546
AMM00448G 0.05mg

Monoclonal CD5 (Mantle Cell Lymphoma Marker) Antibody - With BSA and Azide, Clone: SPM546

Sign In for Pricing
View Details
WDTC1 Peptide - N-terminal region (AAP55145)
AAP55145-100UG 100 µg

WDTC1 Peptide - N-terminal region (AAP55145)

Sign In for Pricing
View Details