Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pparg Peptide - C-terminal region

Pparg Peptide - C-terminal region

Product Specifications

UniProt

O88275

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pparg Rabbit Polyclonal Antibody (orb577006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138838

Preservative

Lyophilized powder

AA Sequence

HPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH6 shRNA Plasmid (m)
sc-141023-SH 20 µg

ALKBH6 shRNA Plasmid (m)

Sign In for Pricing
View Details
Progesterone Impurity 86
RM-P156586-01 10 mg

Progesterone Impurity 86

Sign In for Pricing
View Details
Progesterone Impurity 86
RM-P156586-02 25 mg

Progesterone Impurity 86

Sign In for Pricing
View Details
Progesterone Impurity 86
RM-P156586-03 50 mg

Progesterone Impurity 86

Sign In for Pricing
View Details
Progesterone Impurity 86
RM-P156586-04 100 mg

Progesterone Impurity 86

Sign In for Pricing
View Details
Anti-Inhibin beta A Rabbit Monoclonal Antibody
MBS1757694-01 0.03 mL

Anti-Inhibin beta A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details