Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1564927 Peptide - C-terminal region

RGD1564927 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC188777, Tgif2, RGD1564927

UniProt

B5DEL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGD1564927 Rabbit Polyclonal Antibody (orb324803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128455

Preservative

Lyophilized powder

AA Sequence

PPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDPAPPLLHTPLPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details